PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Sevir.5G382700.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Cenchrinae; Setaria
Family GRAS
Protein Properties Length: 816aa    MW: 89621.6 Da    PI: 6.1697
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Sevir.5G382700.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS396.62.6e-1214398082374
                GRAS   2 velLlecAeavssgdlelaqalLarlselaspdgdpmqRlaayfteALaarlarsvselykalppsetseknsseelaalklfsevsPilk 92 
                         ++lL++cA+ v+++d + a++lL++++++asp+gd  qRla +f+++L+arla+++s++yk++ +++ +    +++l+a++l+  ++P+ k
  Sevir.5G382700.1.p 439 ETLLIHCAQSVATDDRRGATELLKQIRQHASPKGDGDQRLAYCFANGLEARLAGNGSQIYKSVIMTRFP---CTDVLKAYQLYLAACPFKK 526
                         789*************************************************************99999...9****************** PP

                GRAS  93 fshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpegppslRiTgvgspesg..skeeleetgerLakfAeelgvpfefnvl 181
                         +sh+ aNq+I++ave++++vHi+D++i +G+QWp+L+q L++Rp+gpp+lRiTg++ p++g   +e++eetg+ L+++A++++vpfef++ 
  Sevir.5G382700.1.p 527 ISHFFANQTIMNAVEKAKKVHIVDYGIYYGFQWPCLIQRLSTRPGGPPRLRITGIDTPQPGfrPAERIEETGRYLKDYAQTFNVPFEFKA- 616
                         ******************************************************************************************. PP

                GRAS 182 vakrledleleeLrvkpgEalaVnlvlqlhrlldesvsleserdevLklvkslsPkvvvvveqeadhnsesFlerflealeyysalfdsle 272
                         +a+r+e++++e+L+++++E l+Vn++++ ++l+desv  es+r+ vL+++++++P+++++   + ++n++ F+ rf eal +ysa+fd+le
  Sevir.5G382700.1.p 617 IASRFEAVQIEDLQIEKDELLIVNCMFKFKTLMDESVVAESPRNMVLNTIRKMNPHLFIHGIINGSYNAPFFVSRFREALFHYSAVFDMLE 707
                         7****************************************************************************************** PP

                GRAS 273 aklpreseerikvErellgreivnvvacegaerrerhetlekWrerleeaGFkpvplsekaakqaklllrkvksdgyrveeesgslvlgWk 363
                         +++pr++e+r  +E +l+gre+ nv++ceg er er et+++W+ r ++aGFk++p++++++k a+  +r +++d + ++e++++l++gWk
  Sevir.5G382700.1.p 708 TNIPRDNEQRLLIESALFGREAINVISCEGMERMERPETYKQWQVRNQRAGFKQLPMNQDIMKRAREKVRCYHKD-FIIDEDNKWLLQGWK 797
                         *************************************************************************77.*************** PP

                GRAS 364 drpLvsvSaWr 374
                         +r L+++S W+
  Sevir.5G382700.1.p 798 GRILMALSTWK 808
                         **********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098569.171412789IPR005202Transcription factor GRAS
PfamPF035148.8E-119439808IPR005202Transcription factor GRAS
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009410Biological Processresponse to xenobiotic stimulus
GO:0045893Biological Processpositive regulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005829Cellular Componentcytosol
Sequence ? help Back to Top
Protein Sequence    Length: 816 aa     Download sequence    Send to blast
MVMDTGLHEL CALLPGSKRD GHLPIYPQIA AAAANGFTAE DLESLLFLPH DGIAAAAGVG  60
GGYLNVAPTT VVPPASTNRA SPPRDAAAAP APAAAGQPDD SEAFSDIVLG YINRMLMAED  120
IDDKFEHYPE HSALLAAEKP FLEILADQPT SSGGSAVESP DGSSVTNSCN SFGSCSCGAA  180
ASDGFGAVPT PALDFPSAAF LQPPQLYQDL SPESSVVDAG GPWPYDPTEF YQLQTNPVPE  240
ALLSQSPSFA SSNGSGVALS DGFGSLLSSS GVMPDVGLTD FVVQSQQAMQ FCRGLEEASR  300
FLPDESKLVI DLEKPASVTG LVANVKEEKR FAEVKTEKAD VEAAIHRGKK HFYGDDLDAE  360
EGRCSKHSAS AIDTDHLVRE MMDKVLLCNG ETCSKGVKEL REALQHDVAR HSHGGHGKGS  420
GHGKGRGKKQ PKKEIVDLET LLIHCAQSVA TDDRRGATEL LKQIRQHASP KGDGDQRLAY  480
CFANGLEARL AGNGSQIYKS VIMTRFPCTD VLKAYQLYLA ACPFKKISHF FANQTIMNAV  540
EKAKKVHIVD YGIYYGFQWP CLIQRLSTRP GGPPRLRITG IDTPQPGFRP AERIEETGRY  600
LKDYAQTFNV PFEFKAIASR FEAVQIEDLQ IEKDELLIVN CMFKFKTLMD ESVVAESPRN  660
MVLNTIRKMN PHLFIHGIIN GSYNAPFFVS RFREALFHYS AVFDMLETNI PRDNEQRLLI  720
ESALFGREAI NVISCEGMER MERPETYKQW QVRNQRAGFK QLPMNQDIMK RAREKVRCYH  780
KDFIIDEDNK WLLQGWKGRI LMALSTWKPD HKSSH*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5hyz_A2e-554428088375GRAS family transcription factor containing p
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004970541.10.0PREDICTED: scarecrow-like protein 9
SwissprotO809330.0SCL9_ARATH; Scarecrow-like protein 9
TrEMBLK3XEB70.0K3XEB7_SETIT; Uncharacterized protein
STRINGSi000234m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP125183137
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G37650.10.0GRAS family protein